Title THE PHAGE 434 CRO/OR1 COMPLEX AT 2.5 ANGSTROMS RESOLUTION 3cro_500
3D View: Jmol
Citation Harrison, S.C. and Mondragon, A. (1989), Structure of Phage 434 Cro Protein at 2.35 Angstroms Resolution. J.Mol.Biol. 205:179-188
[Abstract] [PubMed]
History Deposition: 1990-07-06
Experimental Method X-RAY DIFFRACTION , Resolution: 2.5 Å
Classification TRANSCRIPTION/DNA
SCOP
Classification
Interface to Domain Species Protein Family Superfamily Fold Class
DNA d3crol_ Bacteriophage 434 [TaxId: 10712] cro 434 Phage repressors lambda repressor-like DNA-binding domains lambda repressor-like DNA-binding domains All alpha proteins
DNA d3cror_ Bacteriophage 434 [TaxId: 10712] cro 434 Phage repressors lambda repressor-like DNA-binding domains lambda repressor-like DNA-binding domains All alpha proteins
Structural and Functional Restraints Polymer Sequence & Restraints
L
         10        20        30        40        50        60     
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGTK
R
         10        20        30        40        50        60   
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYG
Key for HTML output
alpha helix red x
beta sheet blue x
positive phi italic x
solvent accessible upper case x
solvent inaccessible lower case x
disulfide bond cedilla ç
hydrogen bond to DNA orange background & bold x
water-mediated hydrogen bond to DNA orange background & overline x
van der Waals contact to DNA orange background & underline x
hydrogen bond to RNA cyan background & bold x
water-mediated hydrogen bond to RNA cyan background & overline x
van der Waals contact to RNA cyan background & underline x
binding to both DNA and RNA green background & bold x
N/A
3cro_500
3CRO